Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-DYNLL1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DYNLL1 |
Rabbit Polyclonal Anti-DYNLL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1. Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL |
Rabbit Polyclonal Anti-DYNLL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the N terminal of human DYNLL1. Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY |
Rabbit Polyclonal Anti-DYNLL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DYNLL1 |
DYNLL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DYNLL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DYNLL1 |
DYNLL1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1). |
| Modifications | Unmodified |
DYNLL1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human DYNLL1 |
Active filters
Target Symbol
- DYNLL1