DYRK1A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DYRK1A |
DYRK1A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DYRK1A |
DYRK1A rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 6-58 of Human Dyrk1A. |
Rabbit polyclonal anti-DYR1A antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DYR1A. |
Rabbit Polyclonal DYRK1A Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DYRK1A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human DYRK1A. The immunogen is located within the last 50 amino acids of DYRK1A. |
Goat Anti-DYRK1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PHSHQYSDRRQPN-C, from the N Terminus of the protein sequence according to NP_001387.2; NP_569120.1; NP_567824.1; NP_569122.1. |
Rabbit Polyclonal Anti-Dyrk1a Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dyrk1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM |
Rabbit Polyclonal Anti-DYRK1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DYRK1A antibody: synthetic peptide directed towards the N terminal of human DYRK1A. Synthetic peptide located within the following region: INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM |
DYRK1A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DYRK1A |
DYRK1A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 624-763 of human DYRK1A (NP_001387.2). |
Modifications | Unmodified |