Antibodies

View as table Download

DAAM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DAAM1

Rabbit Polyclonal Anti-DAAM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAAM1 Antibody: synthetic peptide directed towards the middle region of human DAAM1. Synthetic peptide located within the following region: GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV

Rabbit Polyclonal Anti-DAAM1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DAAM1

DAAM1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 769-1068 of human DAAM1 (NP_001257449.1).
Modifications Unmodified