Antibodies

Jump to Filters
View as table Download
DAGLB Rabbit Polyclonal Antibody
TA372391

USD 380.00

4 Weeks

DAGLB rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DAGLB
DAGLB (Center) Rabbit Polyclonal Antibody
AP51182PU-N

USD 450.00

2 Weeks

DAGLB (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 497~527 amino acids from the Center region of Human DAGLB.
DAGLB Rabbit Polyclonal Antibody
TA333527

USD 375.00

5 Days

Rabbit Polyclonal Anti-DAGLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAGLB Antibody: synthetic peptide directed towards the middle region of human DAGLB. Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS