Antibodies

Jump to Filters
View as table Download
DAZAP2 (C-term) Rabbit Polyclonal Antibody
AP51189PU-N

USD 450.00

2 Weeks

DAZAP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 118~147 amino acids from the C-terminal region of Human DAZAP2.
DAZAP2 Rabbit Polyclonal Antibody
TA331247

USD 375.00

5 Days

Rabbit Polyclonal Anti-DAZAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DAZAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human DAZAP2. Synthetic peptide located within the following region: AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI
DAZAP2 Rabbit Polyclonal Antibody
TA375329

USD 220.00

3 Weeks

DAZAP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human DAZAP2 (NP_055579.1).
Modifications Unmodified