Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DCC antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DCC. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DCC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCC antibody: synthetic peptide directed towards the middle region of human DCC. Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ |
Rabbit anti DCC Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus (within 1380-1447aa) of Human DCC protein. |
Carrier-free (BSA/glycerol-free) DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DCC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DCC |
| Modifications | Unmodified |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DCC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DCC mouse monoclonal antibody, clone OTI5D10 (formerly 5D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DCC