Germany
Japan
United Kingdom
China
DCUN1D3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DCUN1D3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DCUN1D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCUN1D3 antibody: synthetic peptide directed towards the N terminal of human DCUN1D3. Synthetic peptide located within the following region: GHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPTSSGDAGRESKSNAE |
Rabbit Polyclonal Anti-DCUN1D3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCUN1D3 antibody: synthetic peptide directed towards the C terminal of human DCUN1D3. Synthetic peptide located within the following region: LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV |
Active filters
Target Symbol
- DCUN1D3