Rabbit polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL |
Rabbit Polyclonal Anti-DDX46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the middle region of human DDX46. Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV |
DDX46 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX46 |
DDX46 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 682-1031 of human DDX46 (NP_055644.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China