Antibodies

Jump to Filters
View as table Download
DHRS7B Rabbit Polyclonal Antibody
TA341981

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHRS7B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHRS7B antibody: synthetic peptide directed towards the middle region of human DHRS7B. Synthetic peptide located within the following region: QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
DHRS7B Rabbit Polyclonal Antibody
TA360392

USD 360.00

5 Days

DHRS7B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DHRS7B
DHRS7B Rabbit Polyclonal Antibody
TA366494

USD 380.00

4 Weeks

DHRS7B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human DHRS7B