Antibodies

Jump to Filters
View as table Download
DHRS9 Rabbit Polyclonal Antibody
TA337615

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHRS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
DHRS9 Rabbit Polyclonal Antibody
TA375457

USD 220.00

3 Weeks

DHRS9 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-319 of human DHRS9 (NP_001135743.1).
Modifications Unmodified