Rabbit Polyclonal Anti-DHX30 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX30 antibody: synthetic peptide directed towards the N terminal of human DHX30. Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD |
Rabbit Polyclonal Anti-DHX30 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHX30 antibody: synthetic peptide directed towards the N terminal of human DHX30. Synthetic peptide located within the following region: AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH |
DHX30 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 906-1155 of human DHX30 (NP_055781.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
