Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DIRA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DIRA1 Antibody: A synthesized peptide derived from human DIRA1 |
Rabbit polyclonal anti-DIRA1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DIRA1. |
Rabbit Polyclonal Anti-DIRAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the N terminal of human DIRAS1. Synthetic peptide located within the following region: PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD |
Rabbit Polyclonal Anti-DIRAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the middle region of human DIRAS1. Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK |
Rabbit Polyclonal Anti-DIRAS1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DIRAS1 |
Active filters
Target Symbol
- DIRAS1