Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DKC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKC1 antibody: synthetic peptide directed towards the N terminal of human DKC1. Synthetic peptide located within the following region: EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG |
Rabbit Polyclonal Anti-Dyskerin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dyskerin Antibody: A synthesized peptide derived from human Dyskerin |
Rabbit polyclonal DKC1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DKC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-213 amino acids from the Central region of human DKC1. |
Goat Anti-DKC1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRKRESESESDETPP, from the internal region of the protein sequence according to NP_001354.1. |
Anti-DKC1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human dyskeratosis congenita 1, dyskerin |
DKC1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DKC1 |
DKC1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human DKC1 (NP_001354.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DKC1