Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DLX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX3 Antibody: A synthesized peptide derived from human DLX3 |
Rabbit Polyclonal Anti-DLX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT |
Rabbit Polyclonal anti-DLX3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVN |
Rabbit Polyclonal Anti-DLX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the C terminal of human DLX3. Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY |
DLX3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DLX3 (NP_005211.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DLX3