Rabbit Polyclonal Anti-DMRT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the N terminal of human DMRT2. Synthetic peptide located within the following region: DPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDD |
Goat Anti-DMRT2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRPSSAITRVSQ, from the C Terminus of the protein sequence according to NP_006548.1; NP_870987.2. |
Rabbit Polyclonal anti-DMRT2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the N terminal of human DMRT2. Synthetic peptide located within the following region: RWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFERKAV |
Rabbit polyclonal anti-DMRT2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE |
Germany
Japan
United Kingdom
China
