Germany
Japan
United Kingdom
China
DMRT3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 438-167 amino acids from the C-terminal region of human DMRT3 |
Antibodies
View as table Download
Rabbit polyclonal anti-Dmrt3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dmrt3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDAAATAATASQSSPASQASQPPAPPRPTAELAAAAALRWVAEPQPGTLP |
Rabbit Polyclonal Anti-DMRT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DMRT3 Antibody: synthetic peptide directed towards the middle region of human DMRT3. Synthetic peptide located within the following region: ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP |
Active filters
Target Symbol
- DMRT3