Rabbit Polyclonal Anti-DNAJB12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJB12 antibody: synthetic peptide directed towards the middle region of human DNAJB12. Synthetic peptide located within the following region: ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS |
Rabbit Polyclonal Anti-Dnajb12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dnajb12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV |
Rabbit Polyclonal Anti-Dnajb12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dnajb12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV |
DNAJB12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-409 of human DNAJB12 (NP_060096.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China