Germany
Japan
United Kingdom
China
DNAJC19 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 55-84 amino acids from the Center of human DNAJC19 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DNAJC19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJC19 antibody: synthetic peptide directed towards the C terminal of human DNAJC19. Synthetic peptide located within the following region: LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
Dnajc19 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
DNAJC19 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1). |
| Modifications | Unmodified |
DNAJC19 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DNAJC19