Rabbit Polyclonal antibody to DNAJC7 (DnaJ (Hsp40) homolog, subfamily C, member 7)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 151 and 473 of DNAJC7 (Uniprot ID#Q99615) |
Rabbit Polyclonal Anti-DNAJC7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJC7 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAJC7. Synthetic peptide located within the following region: KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH |
Anti-DNAJC7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human DnaJ (Hsp40) homolog, subfamily C, member 7 |
DNAJC7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human DNAJC7 (NP_003306.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
