Rabbit Polyclonal Anti-DNALI1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the N terminal of human DNALI1. Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA |
DNALI1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide between 214-243 amino acids from the C-terminal region of Human DNALI1. |
Rabbit Polyclonal Anti-DNALI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DNALI1 Antibody: synthetic peptide directed towards the C terminal of human DNALI1. Synthetic peptide located within the following region: ALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVE |
DNALI1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNALI1 |
DNALI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human DNALI1 (NP_003453.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
