Antibodies

View as table Download

DPCD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DPCD

DPCD (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 99-140 amino acids from the Central region of human RP11-529I10.4

Rabbit Polyclonal Anti-DPCD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPCD Antibody: synthetic peptide directed towards the N terminal of human DPCD. Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Rabbit Polyclonal Anti-DPCD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPCD Antibody: synthetic peptide directed towards the middle region of human DPCD. Synthetic peptide located within the following region: APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

Carrier-free (BSA/glycerol-free) DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated