DPCD rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DPCD |
DPCD rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DPCD |
DPCD (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 99-140 amino acids from the Central region of human RP11-529I10.4 |
Rabbit Polyclonal Anti-DPCD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DPCD Antibody: synthetic peptide directed towards the N terminal of human DPCD. Synthetic peptide located within the following region: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK |
Rabbit Polyclonal Anti-DPCD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DPCD Antibody: synthetic peptide directed towards the middle region of human DPCD. Synthetic peptide located within the following region: APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD |
Carrier-free (BSA/glycerol-free) DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
DPCD mouse monoclonal antibody,clone 4B9, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
DPCD mouse monoclonal antibody,clone 4B9, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
DPCD mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
DPCD mouse monoclonal antibody,clone 8A12, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
DPCD mouse monoclonal antibody,clone 8A12, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
DPCD mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |