Germany
Japan
United Kingdom
China
WDR85 (DPH7) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 32-51 amino acids from the N-terminal region of human WDR85 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DPH7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WDR85 Antibody is: synthetic peptide directed towards the N-terminal region of Human WDR85. Synthetic peptide located within the following region: CPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYSF |
DPH7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPH7 |
Active filters
Target Symbol
- DPH7