Rabbit Polyclonal antibody to DYNC1I2 (dynein, cytoplasmic 1, intermediate chain 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 129 and 366 of DYNC1I2 (Uniprot ID#Q13409) |
Rabbit Polyclonal Anti-DYNC1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYNC1I2 antibody: synthetic peptide directed towards the N terminal of human DYNC1I2. Synthetic peptide located within the following region: VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH |
DYNC1I2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DYNC1I2 |
DYNC1I2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DYNC1I2 |
DYNC1I2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DYNC1I2 |
DYNC1I2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 352-612 of human DYNC1I2 (NP_001258717.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
