Rabbit Polyclonal Anti-E2F4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
Rabbit Polyclonal Anti-E2F4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
Rabbit polyclonal anti-E2F4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human E2F4. |
Rabbit Polyclonal anti-E2F4 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4. Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL |
Goat Polyclonal Anti-E2F4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_001941.2 (DPTGVLELPKELSE) |
Goat Polyclonal Anti-Transcription factor E2F4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_001941.2 (PKELSEIFDPTR) |
Carrier-free (BSA/glycerol-free) E2F4 mouse monoclonal antibody,clone OTI10E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) E2F4 mouse monoclonal antibody,clone OTI11H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-E2F4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human E2F4 |
E2F4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human E2F4 |
E2F4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human E2F4. |
Modifications | Unmodified |
E2F4 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human E2F4 |
E2F4 mouse monoclonal antibody,clone OTI10E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
E2F4 mouse monoclonal antibody,clone OTI10E7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
E2F4 mouse monoclonal antibody,clone OTI10E7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
E2F4 mouse monoclonal antibody,clone OTI10E7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
E2F4 mouse monoclonal antibody,clone OTI11H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
E2F4 mouse monoclonal antibody,clone OTI11H1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
E2F4 mouse monoclonal antibody,clone OTI11H1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
E2F4 mouse monoclonal antibody,clone OTI11H1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |