Germany
Japan
United Kingdom
China
Goat Anti-E2F7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLSKQKKFTPERNP, from the internal region of the protein sequence according to NP_976328.2. |
Antibodies
View as table Download
Rabbit polyclonal anti-E2f7 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2f7 antibody: synthetic peptide directed towards the N terminal of mouse E2f7. Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE |
E2F7 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 590-619 amino acids from the Central region of Human E2F7 |
Rabbit polyclonal anti-E2F7 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F7 antibody: synthetic peptide directed towards the N terminal of mouse E2F7. Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA |
Rabbit Polyclonal Anti-E2f7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2f7 antibody is: synthetic peptide directed towards the middle region of Rat E2f7. Synthetic peptide located within the following region: NSLQLDVVGDSAVDDYEKRRPSRKQKSLGLLCQKFLARYPSYPLSTEKTT |
Anti-E2F7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 53-66 amino acids of human E2F transcription factor 7 |
E2F7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 540-740 of human E2F7 (NP_976328.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- E2F7