Germany
Japan
United Kingdom
China
Goat Anti-EBF1 / COE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HNQLPALANTSV, from the internal region of the protein sequence according to NP_076870.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-EBF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBF1 antibody: synthetic peptide directed towards (50ug) human EBF1.. Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS |
Rabbit Polyclonal anti-EBF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBF1 antibody: synthetic peptide directed towards the N terminal of human EBF1. Synthetic peptide located within the following region: MCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCL |
EBF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human EBF1 (NP_076870.1). |
| Modifications | Unmodified |
EBF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human EBF1 (NP_076870.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EBF1