Antibodies

Jump to Filters
View as table Download
emopamil binding protein (EBP) Rabbit Polyclonal Antibody
TA341847

USD 375.00

5 Days

Rabbit Polyclonal Anti-EBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBP antibody: synthetic peptide directed towards the N terminal of human EBP. Synthetic peptide located within the following region: LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
emopamil binding protein (EBP) Rabbit Polyclonal Antibody
TA375695

USD 220.00

3 Weeks

EBP Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1).
Modifications Unmodified