Antibodies

View as table Download

Rabbit Polyclonal Anti-ECHDC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR

Rabbit Polyclonal Anti-ECHDC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

ECHDC2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of human ECHDC2 (NP_001185890.1).
Modifications Unmodified