Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EEA1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the middle region of human EEA1. Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA |
Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD |
EEA1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EEA1 |
Rabbit Polyclonal anti-EEA1 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSAS |
Anti-EEA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.12~16(R-V-G-S-Q)derived from Human EEA1. |
EEA1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EEA1 |
Active filters
Target Symbol
- EEA1