Antibodies

Jump to Filters
View as table Download
EEF1B2 Rabbit Polyclonal Antibody
TA340194

USD 375.00

5 Days

Rabbit Polyclonal Anti-EEF1B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF1B2 antibody: synthetic peptide directed towards the middle region of human EEF1B2. Synthetic peptide located within the following region: VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
EEF1B2 Rabbit Polyclonal Antibody
TA375722

USD 328.00

3 Weeks

EEF1B2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human EEF1B2 (NP_001032752.1).
Modifications Unmodified