Antibodies

Jump to Filters
View as table Download
KIAA0494 (EFCAB14) Rabbit Polyclonal Antibody
TA308984

USD 415.00

5 Days

Rabbit Polyclonal antibody to KIAA0494 (KIAA0494)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 243 and 495 of KIAA0494 (Uniprot ID#O75071)
KIAA0494 (EFCAB14) Rabbit Polyclonal Antibody
TA341958

USD 310.00

5 Days

Rabbit Polyclonal Anti-KIAA0494 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0494 antibody: synthetic peptide directed towards the N terminal of human KIAA0494. Synthetic peptide located within the following region: DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV
KIAA0494 (EFCAB14) Rabbit Polyclonal Antibody
TA341957

USD 375.00

5 Days

Rabbit Polyclonal Anti-4732418C07Rik Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-4732418C07Rik antibody is: synthetic peptide directed towards the C-terminal region of 4732418C07Rik. Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL