Antibodies

View as table Download

Rabbit Polyclonal antibody to KIAA0494 (KIAA0494)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 243 and 495 of KIAA0494 (Uniprot ID#O75071)

Rabbit Polyclonal Anti-KIAA0494 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0494 antibody: synthetic peptide directed towards the N terminal of human KIAA0494. Synthetic peptide located within the following region: DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV

Rabbit Polyclonal Anti-4732418C07Rik Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-4732418C07Rik antibody is: synthetic peptide directed towards the C-terminal region of 4732418C07Rik. Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL