Antibodies

View as table Download

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV

EFEMP1 (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

EFEMP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 126-156aa) of human Fibulin-3

Rabbit Polyclonal Fibulin 3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fibulin 3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human Fibulin 3.

Rabbit polyclonal anti-EFEMP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFEMP1.

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV

EFEMP1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Carrier-free (BSA/glycerol-free) EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EFEMP1 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated