Rabbit Monoclonal antibody against Fibulin-4 (EFEMP2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Fibulin-4 (EFEMP2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-EFEMP2 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFEMP2. |
Rabbit Polyclonal Anti-EFEMP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFEMP2 Antibody: A synthesized peptide derived from human EFEMP2 |
EFEMP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 393-422aa) of human Fibulin-4 |
Rabbit Polyclonal Anti-EFEMP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EFEMP2 Antibody: synthetic peptide directed towards the middle region of human EFEMP2. Synthetic peptide located within the following region: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF |
EFEMP2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-250 of human EFEMP2 (NP_058634.4). |
Modifications | Unmodified |