EFHD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EFHD2 |
EFHD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EFHD2 |
Goat Polyclonal Antibody against EFHD2
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CAAFKELQSTFK, from the C Terminus of the protein sequence according to NP_077305.2. |
Rabbit Polyclonal EFHD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EFHD2 antibody was raised against a 16 amino acid peptide near the amino terminus of human EFHD2. |
Rabbit Polyclonal Anti-EFHD2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFHD2 antibody: synthetic peptide directed towards the N terminal of human EFHD2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG |
EFHD2 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | EFHD2 antibody was raised against synthetic peptide - KLH conjugated |
EFHD2 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EFHD2 |
EFHD2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-78 of human EFHD2 (NP_077305.2). |
Modifications | Unmodified |