Antibodies

View as table Download

EFHD2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EFHD2

Goat Polyclonal Antibody against EFHD2

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CAAFKELQSTFK, from the C Terminus of the protein sequence according to NP_077305.2.

Rabbit Polyclonal EFHD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EFHD2 antibody was raised against a 16 amino acid peptide near the amino terminus of human EFHD2.

Rabbit Polyclonal Anti-EFHD2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFHD2 antibody: synthetic peptide directed towards the N terminal of human EFHD2. Synthetic peptide located within the following region: MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG

EFHD2 (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen EFHD2 antibody was raised against synthetic peptide - KLH conjugated

EFHD2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EFHD2

EFHD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-78 of human EFHD2 (NP_077305.2).
Modifications Unmodified