Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EIF3S9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP |
EIF3B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EIF3B |
EIF3B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3B |
EIF3B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EIF3B |
eIF3B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EIF3B