Germany
Japan
United Kingdom
China
Antibodies
View as table Download
eIF3s8 (EIF3C) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 537-567 amino acids from the Central region of human EIF3C |
Rabbit Polyclonal Anti-EIF3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3C antibody is: synthetic peptide directed towards the N-terminal region of Human EIF3C. Synthetic peptide located within the following region: NEMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEED |
EIF3C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EIF3C |
EIF3C rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF3C |
EIF3C Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 694-913 of human EIF3C (NP_003743.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EIF3C