Antibodies

View as table Download

Rabbit Polyclonal Anti-EIF3G Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Rabbit Polyclonal Anti-EIF3S4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3S4 antibody: synthetic peptide directed towards the N terminal of human EIF3S4. Synthetic peptide located within the following region: SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK

EIF3G rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EIF3G

EIF3G rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EIF3G

EIF3G Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human EIF3G (NP_003746.2).
Modifications Unmodified