Rabbit Polyclonal Anti-EIF3G Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
Rabbit Polyclonal Anti-EIF3S4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3S4 antibody: synthetic peptide directed towards the N terminal of human EIF3S4. Synthetic peptide located within the following region: SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK |
EIF3G rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF3G |
Germany
Japan
United Kingdom
China
