Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-eIF5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RPPHRASFLKRLESK, from the internal region (near N Terminus) of the protein sequence according to NP_001137232.1. |
Rabbit Polyclonal Anti-EIF5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EIF5A Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF5A. Synthetic peptide located within the following region: LKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVP |
EIF5A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1 |
EIF5A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IF5A1 |
EIF5A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EIF5A |
Active filters
Target Symbol
- EIF5A