Rabbit Polyclonal Anti-ELAVL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELAVL4 antibody: synthetic peptide directed towards the N terminal of human ELAVL4. Synthetic peptide located within the following region: MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG |
ELAVL4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELAV4 |
ELAVL4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-366 of human ELAVL4 (NP_001138246.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China