Antibodies

Jump to Filters
View as table Download
ELAVL4 Rabbit Polyclonal Antibody
TA343909

USD 475.00

5 Days

Rabbit Polyclonal Anti-ELAVL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELAVL4 antibody: synthetic peptide directed towards the N terminal of human ELAVL4. Synthetic peptide located within the following region: MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
ELAVL4 Rabbit Polyclonal Antibody
TA360079

USD 360.00

5 Days

ELAVL4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELAV4
ELAVL4 Rabbit Polyclonal Antibody
TA375849

USD 410.00

3 Weeks

ELAVL4 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified