Antibodies

Jump to Filters
View as table Download
ELL3 Rabbit Polyclonal Antibody
TA343230

USD 375.00

5 Days

Rabbit Polyclonal Anti-ELL3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ell3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ell3. Synthetic peptide located within the following region: PEHKVLEDKIVQEYKKFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEE