Rabbit Polyclonal Anti-ELMOD1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ELMOD1 antibody is: synthetic peptide directed towards the N-terminal region of Human ELMOD1. Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA |
Rabbit Polyclonal Anti-ELMOD1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELMOD1 antibody: synthetic peptide directed towards the middle region of human ELMOD1. Synthetic peptide located within the following region: CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI |
Germany
Japan
United Kingdom
China