Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-ELMOD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELMOD2 antibody: synthetic peptide directed towards the N terminal of human ELMOD2. Synthetic peptide located within the following region: FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN |
ELMOD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-293 of human ELMOD2 (NP_714913.1). |
| Modifications | Unmodified |
ELMOD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 5-95 of human ELMOD2 (NP_714913.1). |
| Modifications | Unmodified |
ELMOD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse ELMOD2 |
| Modifications | Unmodified |
ELMOD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 5-95 of human ELMOD2 (NP_714913.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ELMOD2