Antibodies

Jump to Filters
View as table Download
RBED1 (ELMOD3) Rabbit Polyclonal Antibody
TA342950

USD 375.00

5 Days

Rabbit Polyclonal Anti-ELMOD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELMOD3 antibody: synthetic peptide directed towards the C terminal of human ELMOD3. Synthetic peptide located within the following region: FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF
RBED1 (ELMOD3) Rabbit Polyclonal Antibody
TA375866

USD 220.00

3 Weeks

ELMOD3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1).
Modifications Unmodified