Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ELOVL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 247-277 amino acids from the C-terminal region of Human ELOVL5. |
Rabbit Polyclonal Anti-ELOVL5 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Panda (93%); Goat, Dog, Bat, Bovine, Rabbit, Opossum (87%); Elephant, Horse, Turkey, Chicken, Lizard (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 17 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset (100%); Gibbon, Mouse, Hamster, Elephant, Rabbit (94%); Rat, Dog, Panda (88%); Bat, Bovine, Goat (82%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 18 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Elephant, Rabbit (100%); Marmoset, Mouse, Dog (94%); Rat, Hamster, Panda (89%); Bat (83%). |
ELOVL5 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ELOVL5 |
ELOVL5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ELOVL5 |
ELOVL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human ELOVL5 (NP_001229757.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ELOVL5