EMX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EMX2 |
EMX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EMX2 |
Rabbit Polyclonal EMX2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EMX2 antibody was raised against an 18 amino acid synthetic peptide near the center of human EMX2. |
Rabbit Polyclonal anti-EMX2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EMX2 antibody is: synthetic peptide directed towards the N-terminal region of Human EMX2. Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG |
EMX2 (103-201) mouse monoclonal antibody, clone 4F7, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Rabbit polyclonal anti-EMX2 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EMX2. |
Rabbit Polyclonal EMX2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EMX2 antibody was raised against an 16 amino acid synthetic peptide near the amino terminus of human EMX2. |
EMX2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EMX2 |