Rabbit Polyclonal Anti-ENOPH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the middle region of human ENOPH1. Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS |
Rabbit Polyclonal Anti-ENOPH1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the N terminal of human ENOPH1. Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI6B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4A8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI6B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI6B6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI6B6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ENOPH1 mouse monoclonal antibody,clone OTI6B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4E1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ENOPH1 mouse monoclonal antibody,clone OTI4E1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI4A8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4A8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4A8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ENOPH1 mouse monoclonal antibody,clone OTI4A8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China