Antibodies

Jump to Filters
View as table Download
ENOX2 (N-term) Rabbit Polyclonal Antibody
AP51432PU-N

USD 512.00

2 Weeks

ENOX2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human ENOX2
ENOX2 Rabbit Polyclonal Antibody
TA342764

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENOX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENOX2 antibody: synthetic peptide directed towards the N terminal of human ENOX2. Synthetic peptide located within the following region: YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE
ENOX2 Rabbit Polyclonal Antibody
TA357640

USD 360.00

5 Days

ENOX2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human ENOX2
ENOX2 Rabbit Polyclonal Antibody
TA375901

USD 275.00

3 Weeks

ENOX2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 411-610 of human ENOX2 (NP_872114.1).
Modifications Unmodified