Rabbit Polyclonal Anti-Eomes Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Eomes antibody: synthetic peptide directed towards the C terminal of human Eomes. Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY |
EOMES (TBR2) Rabbit Polyclonal Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EOMES (TBR2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 26-57 amino acids from the N-terminal region of human EOMES (TBR2). |
Rabbit Polyclonal anti-EOMES antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the N terminal of human EOMES. Synthetic peptide located within the following region: SVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLS |
Rabbit Polyclonal Anti-EOMES Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT |
Eomes Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
EOMES Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EOMES. |
Germany
Japan
United Kingdom
China
