Antibodies

View as table Download

Rabbit Polyclonal Anti-EPHA7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA7 Antibody: A synthesized peptide derived from human EPHA7

Rabbit polyclonal anti-EPHA7 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA7.

Rabbit polyclonal EPHA7 (Tyr791) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EPHA7around the phosphorylation site of tyrosine 791.
Modifications Phospho-specific

Rabbit polyclonal EPHA7 (Ab-791) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPHA7.

Rabbit Polyclonal Anti-EPHA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA7 antibody is: synthetic peptide directed towards the C-terminal region of Human EPHA7. Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL

Rabbit Polyclonal Anti-EPHA7 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human EPHA7

EPHA7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7

EPHA7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-190 of human EPHA7 (NP_004431.1).
Modifications Unmodified