Germany
Japan
United Kingdom
China
Rabbit Polyclonal EPRS Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-EPRS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPRS antibody: synthetic peptide directed towards the middle region of human EPRS. Synthetic peptide located within the following region: KSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKK |
Rabbit Polyclonal Anti-EPRS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPRS antibody: synthetic peptide directed towards the middle region of human EPRS. Synthetic peptide located within the following region: GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL |
EPRS Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EPRS